Cart 79 Product Products 28 610,25 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-FG...259,07 € -
1 x IL-4I1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x TPX2...259,07 € -
-
-
-
-
1 x LAT...259,07 € -
-
-
-
-
-
-
1 x HSF-27...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
28 610,25 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 79 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 28 610,25 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 28 610,25 €
Data sheet of DTNA purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about DTNA purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00001837-B01P |
| Product name: | DTNA purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human DTNA protein. |
| Gene id: | 1837 |
| Gene name: | DTNA |
| Gene alias: | D18S892E|DRP3|DTN|FLJ96209|LVNC1 |
| Gene description: | dystrobrevin, alpha |
| Genbank accession: | BC005300.1 |
| Immunogen: | DTNA (AAH05300.1, 1 a.a. ~ 371 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSSDGAFGGCV |
| Protein accession: | AAH05300.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of purified MaxPab antibody to DTNA on 293T cell. [antibody concentration 1 ug/ml] |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |