Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DSCR1 monoclonal antibody (M01A), clone 1G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about DSCR1 monoclonal antibody (M01A), clone 1G7
| Brand: | Abnova |
| Reference: | H00001827-M01A |
| Product name: | DSCR1 monoclonal antibody (M01A), clone 1G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DSCR1. |
| Clone: | 1G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1827 |
| Gene name: | RCAN1 |
| Gene alias: | ADAPT78|CSP1|DSC1|DSCR1|MCIP1|RCN1 |
| Gene description: | regulator of calcineurin 1 |
| Genbank accession: | BC002864 |
| Immunogen: | DSCR1 (AAH02864, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPN |
| Protein accession: | AAH02864 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DSCR1 monoclonal antibody (M01A), clone 1G7. Western Blot analysis of DSCR1 expression in COLO 320 HSR ( Cat # L020V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Down syndrome candidate region 1 isoform 1 mediates angiogenesis through the calcineurin-NFAT pathway.Qin L, Zhao D, Liu X, Nagy JA, Hoang MV, Brown LF, Dvorak HF, Zeng H. Mol Cancer Res. 2006 Nov;4(11):811-20. |