Brand: | Abnova |
Reference: | H00001808-M01 |
Product name: | DPYSL2 monoclonal antibody (M01), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPYSL2. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 1808 |
Gene name: | DPYSL2 |
Gene alias: | CRMP2|DHPRP2|DRP-2|DRP2 |
Gene description: | dihydropyrimidinase-like 2 |
Genbank accession: | NM_001386 |
Immunogen: | DPYSL2 (NP_001377.1, 470 a.a. ~ 571 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL |
Protein accession: | NP_001377.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DPYSL2 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Quantitative Proteome Analysis of Pluripotent Cells by iTRAQ Mass Tagging Reveals Post-transcriptional Regulation of Proteins Required for ES Cell Self-renewalO'Brien RN, Shen Z, Tachikawa K, Lee PA, Briggs SP. Mol Cell Proteomics. 2010 Oct;9(10):2238-51. Epub 2010 May 31. |