Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DPT monoclonal antibody (M08), clone 2A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about DPT monoclonal antibody (M08), clone 2A11
| Brand: | Abnova |
| Reference: | H00001805-M08 |
| Product name: | DPT monoclonal antibody (M08), clone 2A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DPT. |
| Clone: | 2A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1805 |
| Gene name: | DPT |
| Gene alias: | TRAMP |
| Gene description: | dermatopontin |
| Genbank accession: | NM_001937 |
| Immunogen: | DPT (NP_001928.2, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
| Protein accession: | NP_001928.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DPT is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Optimized Culture Conditions for Tissue Explants of Uterine Leiomyoma.Fiebitz A, Fritsch M, Reichelt U, Ruester C, Chiantera V, Vercellino GF, Darwish A, Schneider A, Mechsner S. Clin. Lab. DOI: 10.7754/ Clin.Lab.2012.111117 |