Brand: | Abnova |
Reference: | H00001805-M08 |
Product name: | DPT monoclonal antibody (M08), clone 2A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPT. |
Clone: | 2A11 |
Isotype: | IgG2a Kappa |
Gene id: | 1805 |
Gene name: | DPT |
Gene alias: | TRAMP |
Gene description: | dermatopontin |
Genbank accession: | NM_001937 |
Immunogen: | DPT (NP_001928.2, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
Protein accession: | NP_001928.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DPT is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Optimized Culture Conditions for Tissue Explants of Uterine Leiomyoma.Fiebitz A, Fritsch M, Reichelt U, Ruester C, Chiantera V, Vercellino GF, Darwish A, Schneider A, Mechsner S. Clin. Lab. DOI: 10.7754/ Clin.Lab.2012.111117 |