Brand: | Abnova |
Reference: | H00001803-M03 |
Product name: | DPP4 monoclonal antibody (M03), clone 1C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPP4. |
Clone: | 1C5 |
Isotype: | IgG1 Kappa |
Gene id: | 1803 |
Gene name: | DPP4 |
Gene alias: | ADABP|ADCP2|CD26|DPPIV|TP103 |
Gene description: | dipeptidyl-peptidase 4 |
Genbank accession: | BC065265 |
Immunogen: | DPP4 (AAH65265, 352 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP |
Protein accession: | AAH65265 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DPP4 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |