Brand: | Abnova |
Reference: | H00001802-M02 |
Product name: | DPH2 monoclonal antibody (M02), clone 5B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPH2. |
Clone: | 5B10 |
Isotype: | IgG2a Kappa |
Gene id: | 1802 |
Gene name: | DPH2 |
Gene alias: | DPH2L2 |
Gene description: | DPH2 homolog (S. cerevisiae) |
Genbank accession: | NM_001384 |
Immunogen: | DPH2 (NP_001375, 125 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS |
Protein accession: | NP_001375 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | DPH2 monoclonal antibody (M02), clone 5B10 Western Blot analysis of DPH2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |