Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00001778-D01P |
| Product name: | DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DYNC1H1 protein. |
| Gene id: | 1778 |
| Gene name: | DYNC1H1 |
| Gene alias: | DHC1|DHC1a|DKFZp686P2245|DNCH1|DNCL|DNECL|DYHC|Dnchc1|HL-3|KIAA0325|p22 |
| Gene description: | dynein, cytoplasmic 1, heavy chain 1 |
| Genbank accession: | BC064521 |
| Immunogen: | DYNC1H1 (AAH64521.1, 1 a.a. ~ 197 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV |
| Protein accession: | AAH64521.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DYNC1H1 expression in transfected 293T cell line (H00001778-T03) by DYNC1H1 MaxPab polyclonal antibody. Lane 1: DYNC1H1 transfected lysate(22.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |