View larger

DLX6 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of DLX6 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00001750-A01
Product name:	DLX6 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant DLX6.
Gene id:	1750
Gene name:	DLX6
Gene alias:	MGC125282\|MGC125283\|MGC125284\|MGC125285
Gene description:	distal-less homeobox 6
Genbank accession:	XM_376652
Immunogen:	DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Protein accession:	XP_376652
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.01 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice