Cart 34 Product Products 24 464,71 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 34 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 24 464,71 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 24 729,71 €
Data sheet of DLX5 monoclonal antibody (M12), clone 3B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
More info about DLX5 monoclonal antibody (M12), clone 3B11
| Brand: | Abnova |
| Reference: | H00001749-M12 |
| Product name: | DLX5 monoclonal antibody (M12), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DLX5. |
| Clone: | 3B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1749 |
| Gene name: | DLX5 |
| Gene alias: | - |
| Gene description: | distal-less homeobox 5 |
| Genbank accession: | NM_005221 |
| Immunogen: | DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH |
| Protein accession: | NP_005212 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | DLX5 monoclonal antibody (M12), clone 3B11 Western Blot analysis of DLX5 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |