| Brand: | Abnova |
| Reference: | H00001749-M07 |
| Product name: | DLX5 monoclonal antibody (M07), clone 4H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DLX5. |
| Clone: | 4H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1749 |
| Gene name: | DLX5 |
| Gene alias: | - |
| Gene description: | distal-less homeobox 5 |
| Genbank accession: | NM_005221 |
| Immunogen: | DLX5 (NP_005212, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR* |
| Protein accession: | NP_005212 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DLX5 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |