No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00001748-D01 |
| Product name: | DLX4 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DLX4 protein. |
| Gene id: | 1748 |
| Gene name: | DLX4 |
| Gene alias: | BP1|DLX7|DLX8|DLX9 |
| Gene description: | distal-less homeobox 4 |
| Genbank accession: | NM_138281.1 |
| Immunogen: | DLX4 (NP_612138.1, 1 a.a. ~ 240 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM |
| Protein accession: | NP_612138.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DLX4 MaxPab mouse polyclonal antibody (B01) (H00001748-B01). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |