| Brand: | Abnova |
| Reference: | H00001746-M08 |
| Product name: | DLX2 monoclonal antibody (M08), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DLX2. |
| Clone: | 3G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1746 |
| Gene name: | DLX2 |
| Gene alias: | TES-1|TES1 |
| Gene description: | distal-less homeobox 2 |
| Genbank accession: | NM_004405 |
| Immunogen: | DLX2 (NP_004396, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGT |
| Protein accession: | NP_004396 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |