| Brand: | Abnova |
| Reference: | H00001745-M15 |
| Product name: | DLX1 monoclonal antibody (M15), clone 4B7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DLX1. |
| Clone: | 4B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1745 |
| Gene name: | DLX1 |
| Gene alias: | - |
| Gene description: | distal-less homeobox 1 |
| Genbank accession: | NM_178120 |
| Immunogen: | DLX1 (NP_835221, 181 a.a. ~ 254 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL* |
| Protein accession: | NP_835221 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.25 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | DLX1 monoclonal antibody (M15), clone 4B7. Western Blot analysis of DLX1 expression in Raw 264.7. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |