Brand: | Abnova |
Reference: | H00001739-M01A |
Product name: | DLG1 monoclonal antibody (M01A), clone 1D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DLG1. |
Clone: | 1D8 |
Isotype: | IgG2a Kappa |
Gene id: | 1739 |
Gene name: | DLG1 |
Gene alias: | DKFZp761P0818|DKFZp781B0426|DLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlg |
Gene description: | discs, large homolog 1 (Drosophila) |
Genbank accession: | NM_004087 |
Immunogen: | DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS |
Protein accession: | NP_004078 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |