No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001723-M01 |
Product name: | DHODH monoclonal antibody (M01), clone 6E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DHODH. |
Clone: | 6E1 |
Isotype: | IgG2a Lambda |
Gene id: | 1723 |
Gene name: | DHODH |
Gene alias: | DHOdehase |
Gene description: | dihydroorotate dehydrogenase |
Genbank accession: | NM_001361 |
Immunogen: | DHODH (NP_001352, 32 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ |
Protein accession: | NP_001352 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to DHODH on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Inhibition of Pyrimidine Biosynthesis Pathway Suppresses Viral Growth through Innate Immunity.Lucas-Hourani M, Dauzonne D, Jorda P, Cousin G, Lupan A, Helynck O, Caignard G, Janvier G, Andre-Leroux G, Khiar S, Escriou N, Despres P, Jacob Y, Munier-Lehmann H, Tangy F, Vidalain PO PLoS Pathog. 2013;9(10):e1003678. doi: 10.1371/journal.ppat.1003678. Epub 2013 Oct 3. |