| Brand: | Abnova |
| Reference: | H00001723-M01 |
| Product name: | DHODH monoclonal antibody (M01), clone 6E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DHODH. |
| Clone: | 6E1 |
| Isotype: | IgG2a Lambda |
| Gene id: | 1723 |
| Gene name: | DHODH |
| Gene alias: | DHOdehase |
| Gene description: | dihydroorotate dehydrogenase |
| Genbank accession: | NM_001361 |
| Immunogen: | DHODH (NP_001352, 32 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ |
| Protein accession: | NP_001352 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to DHODH on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Inhibition of Pyrimidine Biosynthesis Pathway Suppresses Viral Growth through Innate Immunity.Lucas-Hourani M, Dauzonne D, Jorda P, Cousin G, Lupan A, Helynck O, Caignard G, Janvier G, Andre-Leroux G, Khiar S, Escriou N, Despres P, Jacob Y, Munier-Lehmann H, Tangy F, Vidalain PO PLoS Pathog. 2013;9(10):e1003678. doi: 10.1371/journal.ppat.1003678. Epub 2013 Oct 3. |