No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001719-M01 |
Product name: | DHFR monoclonal antibody (M01), clone 2B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DHFR. |
Clone: | 2B10 |
Isotype: | IgG2a Kappa |
Gene id: | 1719 |
Gene name: | DHFR |
Gene alias: | - |
Gene description: | dihydrofolate reductase |
Genbank accession: | BC003584 |
Immunogen: | DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND |
Protein accession: | AAH03584 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Inflammatory Monocytes Determine Endothelial Nitric Oxide Synthase Uncoupling and Nitro-oxidative Stress Induced by Angiotensin II.Kossmann S, Hu H, Steven S, Schonfelder T, Fraccarollo D, Mikhed Y, Brahler M, Knorr M, Brandt M, Karbach SH, Becker C, Oelze M, Bauersachs J, Widder J, Munzel T, Daiber A, Wenzel P J Biol Chem. 2014 Aug 20. pii: jbc.M114.604231. |