No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00001716-M02 |
Product name: | DGUOK monoclonal antibody (M02), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DGUOK. |
Clone: | 3E9 |
Isotype: | IgG1 Kappa |
Gene id: | 1716 |
Gene name: | DGUOK |
Gene alias: | dGK |
Gene description: | deoxyguanosine kinase |
Genbank accession: | NM_001929 |
Immunogen: | DGUOK (NP_001920, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP |
Protein accession: | NP_001920 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DGUOK expression in transfected 293T cell line by DGUOK monoclonal antibody (M02), clone 3E9. Lane 1: DGUOK transfected lysate(32.056 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |