No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001678-M01 |
Product name: | TIMM8A monoclonal antibody (M01), clone 2F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TIMM8A. |
Clone: | 2F11 |
Isotype: | IgG2a Kappa |
Gene id: | 1678 |
Gene name: | TIMM8A |
Gene alias: | DDP|DDP1|DFN1|MGC12262|MTS |
Gene description: | translocase of inner mitochondrial membrane 8 homolog A (yeast) |
Genbank accession: | NM_004085 |
Immunogen: | TIMM8A (NP_004076, 9 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
Protein accession: | NP_004076 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |