No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00001678-B01P |
Product name: | TIMM8A purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TIMM8A protein. |
Gene id: | 1678 |
Gene name: | TIMM8A |
Gene alias: | DDP|DDP1|DFN1|MGC12262|MTS |
Gene description: | translocase of inner mitochondrial membrane 8 homolog A (yeast) |
Genbank accession: | NM_004085 |
Immunogen: | TIMM8A (NP_004076.1, 1 a.a. ~ 97 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
Protein accession: | NP_004076.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TIMM8A expression in transfected 293T cell line (H00001678-T01) by TIMM8A MaxPab polyclonal antibody. Lane 1: TIMM8A transfected lysate(10.67 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |