No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00001676-M05 |
Product name: | DFFA monoclonal antibody (M05), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DFFA. |
Clone: | 3A11 |
Isotype: | IgG2a Kappa |
Gene id: | 1676 |
Gene name: | DFFA |
Gene alias: | DFF-45|DFF1|ICAD |
Gene description: | DNA fragmentation factor, 45kDa, alpha polypeptide |
Genbank accession: | NM_004401 |
Immunogen: | DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT |
Protein accession: | NP_004392.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-DFFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |