Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 711,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 711,28 €
Data sheet of DES monoclonal antibody (M03), clone 1D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about DES monoclonal antibody (M03), clone 1D12
| Brand: | Abnova |
| Reference: | H00001674-M03 |
| Product name: | DES monoclonal antibody (M03), clone 1D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DES. |
| Clone: | 1D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1674 |
| Gene name: | DES |
| Gene alias: | CMD1I|CSM1|CSM2|FLJ12025|FLJ39719|FLJ41013|FLJ41793 |
| Gene description: | desmin |
| Genbank accession: | NM_001927 |
| Immunogen: | DES (NP_001918.3, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Protein accession: | NP_001918.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DES is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Fluorophore-labeled nanocapsules displaying IgG Fc-binding domains for the simultaneous detection of multiple antigens.Iijima M, Matsuzaki T, Yoshimoto N, Niimi T, Tanizawa K, Kuroda S. Biomaterials. 2011 Aug 23. [Epub ahead of print] |