Brand: | Abnova |
Reference: | H00001667-M03 |
Product name: | DEFA1 monoclonal antibody (M03), clone 1B20 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DEFA1. |
Clone: | 1B20 |
Isotype: | IgG2b Kappa |
Gene id: | 1667 |
Gene name: | DEFA1 |
Gene alias: | DEF1|DEFA2|HNP-1|HP-1|MGC138393|MRS |
Gene description: | defensin, alpha 1 |
Genbank accession: | BC027917 |
Immunogen: | DEFA1 (AAH27917, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
Protein accession: | AAH27917 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |