Cart 1 Product Products 256,00 € (empty)
No products
To be determined Shipping
256,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 256,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 256,00 €
Data sheet of DEFA1 monoclonal antibody (M03), clone 1B20
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about DEFA1 monoclonal antibody (M03), clone 1B20
| Brand: | Abnova |
| Reference: | H00001667-M03 |
| Product name: | DEFA1 monoclonal antibody (M03), clone 1B20 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant DEFA1. |
| Clone: | 1B20 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1667 |
| Gene name: | DEFA1 |
| Gene alias: | DEF1|DEFA2|HNP-1|HP-1|MGC138393|MRS |
| Gene description: | defensin, alpha 1 |
| Genbank accession: | BC027917 |
| Immunogen: | DEFA1 (AAH27917, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Protein accession: | AAH27917 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |