| Brand: | Abnova |
| Reference: | H00001666-M01 |
| Product name: | DECR1 monoclonal antibody (M01), clone 3D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DECR1. |
| Clone: | 3D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1666 |
| Gene name: | DECR1 |
| Gene alias: | DECR|NADPH|SDR18C1 |
| Gene description: | 2,4-dienoyl CoA reductase 1, mitochondrial |
| Genbank accession: | NM_001359 |
| Immunogen: | DECR1 (NP_001350, 236 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS |
| Protein accession: | NP_001350 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DECR1 monoclonal antibody (M01), clone 3D4. Western Blot analysis of DECR1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |