No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001663-A01 |
Product name: | DDX11 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant DDX11. |
Gene id: | 1663 |
Gene name: | DDX11 |
Gene alias: | CHL1|CHLR1|KRG2|MGC133249|MGC9335 |
Gene description: | DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S. cerevisiae) |
Genbank accession: | BC011264 |
Immunogen: | DDX11 (AAH11264, 40 a.a. ~ 129 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GIFESPTGTGKSLSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLVDR |
Protein accession: | AAH11264 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | DDX11 polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of DDX11 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |