| Brand: | Abnova |
| Reference: | H00001660-M01 |
| Product name: | DHX9 monoclonal antibody (M01), clone 3G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DHX9. |
| Clone: | 3G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1660 |
| Gene name: | DHX9 |
| Gene alias: | DDX9|LKP|NDHII|RHA |
| Gene description: | DEAH (Asp-Glu-Ala-His) box polypeptide 9 |
| Genbank accession: | NM_001357 |
| Immunogen: | DHX9 (NP_001348, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP |
| Protein accession: | NP_001348 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to DHX9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Roles of the Linker Region of RNA Helicase A in HIV-1 RNA Metabolism.Xing L, Niu M, Zhao X, Kleiman L PLoS One. 2013 Nov 6;8(11):e78596. doi: 10.1371/journal.pone.0078596. |