No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001659-M07 |
Product name: | DHX8 monoclonal antibody (M07), clone 1D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DHX8. |
Clone: | 1D6 |
Isotype: | IgG1 Kappa |
Gene id: | 1659 |
Gene name: | DHX8 |
Gene alias: | DDX8|HRH1|PRP22|PRPF22 |
Gene description: | DEAH (Asp-Glu-Ala-His) box polypeptide 8 |
Genbank accession: | NM_004941 |
Immunogen: | DHX8 (NP_004932, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW |
Protein accession: | NP_004932 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | DHX8 monoclonal antibody (M07), clone 1D6. Western Blot analysis of DHX8 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |