| Brand: | Abnova |
| Reference: | H00001659-M07 |
| Product name: | DHX8 monoclonal antibody (M07), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DHX8. |
| Clone: | 1D6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1659 |
| Gene name: | DHX8 |
| Gene alias: | DDX8|HRH1|PRP22|PRPF22 |
| Gene description: | DEAH (Asp-Glu-Ala-His) box polypeptide 8 |
| Genbank accession: | NM_004941 |
| Immunogen: | DHX8 (NP_004932, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW |
| Protein accession: | NP_004932 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DHX8 monoclonal antibody (M07), clone 1D6. Western Blot analysis of DHX8 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |