No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00001652-M04 |
Product name: | DDT monoclonal antibody (M04), clone 1D5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DDT. |
Clone: | 1D5 |
Isotype: | IgG2b Kappa |
Gene id: | 1652 |
Gene name: | DDT |
Gene alias: | DDCT |
Gene description: | D-dopachrome tautomerase |
Genbank accession: | BC015508 |
Immunogen: | DDT (AAH15508, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL |
Protein accession: | AAH15508 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged DDT is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |