No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00001650-M06 |
Product name: | DDOST monoclonal antibody (M06), clone 2D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDOST. |
Clone: | 2D7 |
Isotype: | IgG2a Kappa |
Gene id: | 1650 |
Gene name: | DDOST |
Gene alias: | AGE-R1|KIAA0115|MGC2191|OK/SW-cl.45|OST|OST48|WBP1 |
Gene description: | dolichyl-diphosphooligosaccharide-protein glycosyltransferase |
Genbank accession: | NM_005216 |
Immunogen: | DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP |
Protein accession: | NP_005207 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in human stomach. |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |