| Brand: | Abnova |
| Reference: | H00001650-M06 |
| Product name: | DDOST monoclonal antibody (M06), clone 2D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DDOST. |
| Clone: | 2D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1650 |
| Gene name: | DDOST |
| Gene alias: | AGE-R1|KIAA0115|MGC2191|OK/SW-cl.45|OST|OST48|WBP1 |
| Gene description: | dolichyl-diphosphooligosaccharide-protein glycosyltransferase |
| Genbank accession: | NM_005216 |
| Immunogen: | DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP |
| Protein accession: | NP_005207 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in human stomach. |
| Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |