DDIT3 monoclonal antibody (M03), clone 2C4 View larger

DDIT3 monoclonal antibody (M03), clone 2C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDIT3 monoclonal antibody (M03), clone 2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DDIT3 monoclonal antibody (M03), clone 2C4

Brand: Abnova
Reference: H00001649-M03
Product name: DDIT3 monoclonal antibody (M03), clone 2C4
Product description: Mouse monoclonal antibody raised against a partial recombinant DDIT3.
Clone: 2C4
Isotype: IgG2a Kappa
Gene id: 1649
Gene name: DDIT3
Gene alias: CEBPZ|CHOP|CHOP10|GADD153|MGC4154
Gene description: DNA-damage-inducible transcript 3
Genbank accession: BC003637
Immunogen: DDIT3 (AAH03637.1, 94 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEAT
Protein accession: AAH03637.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001649-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DDIT3 monoclonal antibody (M03), clone 2C4 now

Add to cart