Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DDIT3 monoclonal antibody (M01), clone 2G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about DDIT3 monoclonal antibody (M01), clone 2G3
| Brand: | Abnova |
| Reference: | H00001649-M01 |
| Product name: | DDIT3 monoclonal antibody (M01), clone 2G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DDIT3. |
| Clone: | 2G3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1649 |
| Gene name: | DDIT3 |
| Gene alias: | CEBPZ|CHOP|CHOP10|GADD153|MGC4154 |
| Gene description: | DNA-damage-inducible transcript 3 |
| Genbank accession: | BC003637 |
| Immunogen: | DDIT3 (AAH03637, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL |
| Protein accession: | AAH03637 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DDIT3 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Loss of UDP-N-acetylglucosamine 2-epimerase/ N-acetylmannosamine kinase (GNE) induces apoptotic processes in pancreatic carcinoma cells.Kemmner W, Kessel P, Sanchez-Ruderisch H, Moller H, Hinderlich S, Schlag PM, Detjen K. FASEB J. 2011 Nov 2. |