Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GADD45A monoclonal antibody (M01), clone 3D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about GADD45A monoclonal antibody (M01), clone 3D12
| Brand: | Abnova |
| Reference: | H00001647-M01 |
| Product name: | GADD45A monoclonal antibody (M01), clone 3D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GADD45A. |
| Clone: | 3D12 |
| Isotype: | IgG1 kappa |
| Gene id: | 1647 |
| Gene name: | GADD45A |
| Gene alias: | DDIT1|GADD45 |
| Gene description: | growth arrest and DNA-damage-inducible, alpha |
| Genbank accession: | BC011757 |
| Immunogen: | GADD45A (AAH11757, 76 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
| Protein accession: | AAH11757 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged GADD45A is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Decitabine-Induced Demethylation of 5'CpG Island in GADD45A Leads to Apoptosis in Osteosarcoma Cells.Al-Romaih K, Sadikovic B, Yoshimoto M, Wang Y, Zielenska M, Squire JA. Neoplasia. 2008 May;10(5):471-80. |