| Brand: | Abnova |
| Reference: | H00001645-D01 |
| Product name: | AKR1C1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human AKR1C1 protein. |
| Gene id: | 1645 |
| Gene name: | AKR1C1 |
| Gene alias: | 2-ALPHA-HSD|20-ALPHA-HSD|C9|DD1|DDH|DDH1|H-37|HAKRC|MBAB|MGC8954 |
| Gene description: | aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) |
| Genbank accession: | NM_001353.5 |
| Immunogen: | AKR1C1 (NP_001344.2, 1 a.a. ~ 323 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
| Protein accession: | NP_001344.2 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AKR1C1 MaxPab rabbit polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver. |
| Applications: | WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |