View larger

DBP (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of DBP (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00001628-Q01
Product name:	DBP (Human) Recombinant Protein (Q01)
Product description:	Human DBP partial ORF ( NP_001343, 226 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	1628
Gene name:	DBP
Gene alias:	DABP
Gene description:	D site of albumin promoter (albumin D-box) binding protein
Genbank accession:	NM_001352
Immunogen sequence/protein sequence:	RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Protein accession:	NP_001343
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Regulatory mechanism governing the diurnal rhythm of intestinal H+/peptide cotransporter 1 (PEPT1).Saito H, Terada T, Shimakura J, Katsura T, Inui KI. Am J Physiol Gastrointest Liver Physiol. 2008 Aug;295(2):G395-402. Epub 2008 Jun 26.