CYP51A1 polyclonal antibody (A01) View larger

CYP51A1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP51A1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CYP51A1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001595-A01
Product name: CYP51A1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CYP51A1.
Gene id: 1595
Gene name: CYP51A1
Gene alias: CP51|CYP51|CYPL1|LDM|P450-14DM|P450L1
Gene description: cytochrome P450, family 51, subfamily A, polypeptide 1
Genbank accession: NM_000786
Immunogen: CYP51A1 (NP_000777, 410 a.a. ~ 509 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
Protein accession: NP_000777
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001595-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Amyloid precursor protein α- and β-cleaved ectodomains exert opposing control of cholesterol homeostasis via SREBP2.Wang W, Mutka AL, Zmrzljak UP, Rozman D, Tanila H, Gylling H, Remes AM, Huttunen HJ, Ikonen E
FASEB J. 2013 Nov 18.

Reviews

Buy CYP51A1 polyclonal antibody (A01) now

Add to cart