No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001591-A01 |
Product name: | CYP24A1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CYP24A1. |
Gene id: | 1591 |
Gene name: | CYP24A1 |
Gene alias: | CP24|CYP24|MGC126273|MGC126274|P450-CC24 |
Gene description: | cytochrome P450, family 24, subfamily A, polypeptide 1 |
Genbank accession: | NM_000782 |
Immunogen: | CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR |
Protein accession: | NP_000773 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Overexpression of ER and VDR is not sufficient to make ER-negative MDA-MB231 breast cancer cells responsive to 1alpha-Hydroxyvitamin D5.Peng X, Jhaveri P, Hussain-Hakimjee EA, Mehta RG. Carcinogenesis. 2007 May;28(5):1000-7. Epub 2006 Nov 27. |