Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CYP2J2 monoclonal antibody (M01), clone 2D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CYP2J2 monoclonal antibody (M01), clone 2D10
| Brand: | Abnova |
| Reference: | H00001573-M01 |
| Product name: | CYP2J2 monoclonal antibody (M01), clone 2D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP2J2. |
| Clone: | 2D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1573 |
| Gene name: | CYP2J2 |
| Gene alias: | CPJ2 |
| Gene description: | cytochrome P450, family 2, subfamily J, polypeptide 2 |
| Genbank accession: | NM_000775 |
| Immunogen: | CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA |
| Protein accession: | NP_000766 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CYP2J2 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Detection of EETs and HETEs-generating Cytochrome P450 Enzymes and the Effects of their Metabolites on Myometrial and Vascular Function.Pearson T, Warren AY, Barrett DA, Khan RN. Am J Physiol Endocrinol Metab. 2009 Sep;297(3):E647-56. Epub 2009 Jun 23. |