Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CYP2D6 monoclonal antibody (M07), clone 2C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about CYP2D6 monoclonal antibody (M07), clone 2C5
| Brand: | Abnova |
| Reference: | H00001565-M07 |
| Product name: | CYP2D6 monoclonal antibody (M07), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP2D6. |
| Clone: | 2C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1565 |
| Gene name: | CYP2D6 |
| Gene alias: | CPD6|CYP2D|CYP2D@|CYP2DL1|MGC120389|MGC120390|P450-DB1|P450C2D|P450DB1 |
| Gene description: | cytochrome P450, family 2, subfamily D, polypeptide 6 |
| Genbank accession: | NG_003180 |
| Immunogen: | CYP2D6 (NP_000097, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLT |
| Protein accession: | NP_000097 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CYP2D6 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |