| Brand: | Abnova |
| Reference: | H00001540-M02 |
| Product name: | CYLD monoclonal antibody (M02), clone 3A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYLD. |
| Clone: | 3A9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1540 |
| Gene name: | CYLD |
| Gene alias: | CDMT|CYLD1|CYLDI|EAC|FLJ20180|FLJ31664|FLJ78684|HSPC057|KIAA0849|MFT|MFT1|SBS|TEM|USPL2 |
| Gene description: | cylindromatosis (turban tumor syndrome) |
| Genbank accession: | BC012342 |
| Immunogen: | CYLD (AAH12342, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
| Protein accession: | AAH12342 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CYLD is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |