Brand: | Abnova |
Reference: | H00001524-M07 |
Product name: | CX3CR1 monoclonal antibody (M07), clone 10D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CX3CR1. |
Clone: | 10D5 |
Isotype: | IgG2a Kappa |
Gene id: | 1524 |
Gene name: | CX3CR1 |
Gene alias: | CCRL1|CMKBRL1|CMKDR1|GPR13|GPRV28|V28 |
Gene description: | chemokine (C-X3-C motif) receptor 1 |
Genbank accession: | BC028078 |
Immunogen: | CX3CR1 (AAH28078, 1 a.a. ~ 36 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI |
Protein accession: | AAH28078 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (29.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CX3CR1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |