Brand: | Abnova |
Reference: | H00001523-M02 |
Product name: | CUTL1 monoclonal antibody (M02), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CUTL1. |
Clone: | 2D10 |
Isotype: | IgG1 Kappa |
Gene id: | 1523 |
Gene name: | CUX1 |
Gene alias: | CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75 |
Gene description: | cut-like homeobox 1 |
Genbank accession: | NM_001913 |
Immunogen: | CUTL1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI |
Protein accession: | NP_001904.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CUTL1 monoclonal antibody (M02), clone 2D10 Western Blot analysis of CUTL1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |