| Brand: | Abnova |
| Reference: | H00001523-M01 |
| Product name: | CUTL1 monoclonal antibody (M01), clone 2A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CUTL1. |
| Clone: | 2A10 |
| Isotype: | IgG1 kappa |
| Gene id: | 1523 |
| Gene name: | CUX1 |
| Gene alias: | CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75 |
| Gene description: | cut-like homeobox 1 |
| Genbank accession: | NM_001913 |
| Immunogen: | CUTL1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI |
| Protein accession: | NP_001904.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CUTL1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Neocortical Layer Formation of Human Developing Brains and Lissencephalies: Consideration of Layer-Specific Marker Expression.Saito T, Hanai S, Takashima S, Nakagawa E, Okazaki S, Inoue T, Miyata R, Hoshino K, Akashi T, Sasaki M, Goto YI, Hayashi M, Itoh M. Cereb Cortex. 2010 Jul 12. [Epub ahead of print] |