CTSW monoclonal antibody (M01), clone 4A8 View larger

CTSW monoclonal antibody (M01), clone 4A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSW monoclonal antibody (M01), clone 4A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CTSW monoclonal antibody (M01), clone 4A8

Brand: Abnova
Reference: H00001521-M01
Product name: CTSW monoclonal antibody (M01), clone 4A8
Product description: Mouse monoclonal antibody raised against a full length recombinant CTSW.
Clone: 4A8
Isotype: IgG2a Kappa
Gene id: 1521
Gene name: CTSW
Gene alias: LYPN
Gene description: cathepsin W
Genbank accession: BC048255
Immunogen: CTSW (AAH48255, 22 a.a. ~ 376 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP
Protein accession: AAH48255
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001521-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (64.79 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001521-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CTSW is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CTSW monoclonal antibody (M01), clone 4A8 now

Add to cart