Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CTSK monoclonal antibody (M01), clone 2F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CTSK monoclonal antibody (M01), clone 2F1
| Brand: | Abnova |
| Reference: | H00001513-M01 |
| Product name: | CTSK monoclonal antibody (M01), clone 2F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTSK. |
| Clone: | 2F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1513 |
| Gene name: | CTSK |
| Gene alias: | CTS02|CTSO|CTSO1|CTSO2|MGC23107|PKND|PYCD |
| Gene description: | cathepsin K |
| Genbank accession: | BC016058 |
| Immunogen: | CTSK (AAH16058, 220 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM |
| Protein accession: | AAH16058 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CTSK expression in transfected 293T cell line by CTSK monoclonal antibody (M01), clone 2F1. Lane 1: CTSK transfected lysate(37 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Simultaneous expression of Cathepsins B and K in pulmonary adenocarcinomas and squamous cell carcinomas predicts poor recurrence-free and overall survival.Cordes C, Bartling B, Simm A, Afar D, Lautenschlager C, Hansen G, Silber RE, Burdach S, Hofmann HS. Lung Cancer. 2009 Apr;64(1):79-85. Epub 2008 Aug 29. |