Brand: | Abnova |
Reference: | H00001512-M01A |
Product name: | CTSH monoclonal antibody (M01A), clone 3D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTSH. |
Clone: | 3D10 |
Isotype: | IgM Kappa |
Gene id: | 1512 |
Gene name: | CTSH |
Gene alias: | ACC-4|ACC-5|CPSB|DKFZp686B24257|MGC1519|minichain |
Gene description: | cathepsin H |
Genbank accession: | NM_004390 |
Immunogen: | CTSH (NP_004381.2, 157 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYD |
Protein accession: | NP_004381.2 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |