| Brand: | Abnova |
| Reference: | H00001512-M01A |
| Product name: | CTSH monoclonal antibody (M01A), clone 3D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTSH. |
| Clone: | 3D10 |
| Isotype: | IgM Kappa |
| Gene id: | 1512 |
| Gene name: | CTSH |
| Gene alias: | ACC-4|ACC-5|CPSB|DKFZp686B24257|MGC1519|minichain |
| Gene description: | cathepsin H |
| Genbank accession: | NM_004390 |
| Immunogen: | CTSH (NP_004381.2, 157 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYD |
| Protein accession: | NP_004381.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |