Brand: | Abnova |
Reference: | H00001509-D01 |
Product name: | CTSD MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CTSD protein. |
Gene id: | 1509 |
Gene name: | CTSD |
Gene alias: | CLN10|CPSD|MGC2311 |
Gene description: | cathepsin D |
Genbank accession: | NM_001909 |
Immunogen: | CTSD (AAH16320.1, 1 a.a. ~ 412 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
Protein accession: | AAH16320.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in A-431. |
Applications: | WB-Ce,WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |