| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00001499-M05 |
| Product name: | CTNNB1 monoclonal antibody (M05), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTNNB1. |
| Clone: | 4H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1499 |
| Gene name: | CTNNB1 |
| Gene alias: | CTNNB|DKFZp686D02253|FLJ25606|FLJ37923 |
| Gene description: | catenin (cadherin-associated protein), beta 1, 88kDa |
| Genbank accession: | NM_001904 |
| Immunogen: | CTNNB1 (AAH58926, 682 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL |
| Protein accession: | AAH58926 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody (M05), clone 4H4. Lane 1: CTNNB1 transfected lysate(85.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |