Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001499-M03 |
Product name: | CTNNB1 monoclonal antibody (M03), clone 4F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTNNB1. |
Clone: | 4F2 |
Isotype: | IgG2b Kappa |
Gene id: | 1499 |
Gene name: | CTNNB1 |
Gene alias: | CTNNB|DKFZp686D02253|FLJ25606|FLJ37923 |
Gene description: | catenin (cadherin-associated protein), beta 1, 88kDa |
Genbank accession: | NM_001904 |
Immunogen: | CTNNB1 (AAH58926, 682 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL |
Protein accession: | AAH58926 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody (M03), clone 4F2. Lane 1: CTNNB1 transfected lysate(85.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |