CTNNB1 monoclonal antibody (M02), clone 1C9 View larger

CTNNB1 monoclonal antibody (M02), clone 1C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTNNB1 monoclonal antibody (M02), clone 1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce,IF-CTC

More info about CTNNB1 monoclonal antibody (M02), clone 1C9

Brand: Abnova
Reference: H00001499-M02
Product name: CTNNB1 monoclonal antibody (M02), clone 1C9
Product description: Mouse monoclonal antibody raised against a partial recombinant CTNNB1.
Clone: 1C9
Isotype: IgG2a Kappa
Gene id: 1499
Gene name: CTNNB1
Gene alias: CTNNB|DKFZp686D02253|FLJ25606|FLJ37923
Gene description: catenin (cadherin-associated protein), beta 1, 88kDa
Genbank accession: NM_001904
Immunogen: CTNNB1 (AAH58926, 682 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Protein accession: AAH58926
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001499-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001499-M02-13-15-1.jpg
Application image note: Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody (M02), clone 1C9.

Lane 1: CTNNB1 transfected lysate(85.5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce,IF-CTC
Shipping condition: Dry Ice

Reviews

Buy CTNNB1 monoclonal antibody (M02), clone 1C9 now

Add to cart