No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001497-M09 |
Product name: | CTNS monoclonal antibody (M09), clone 5G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTNS. |
Clone: | 5G6 |
Isotype: | IgG2a Kappa |
Gene id: | 1497 |
Gene name: | CTNS |
Gene alias: | CTNS-LSB|PQLC4 |
Gene description: | cystinosis, nephropathic |
Genbank accession: | NM_004937 |
Immunogen: | CTNS (NP_004928, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY |
Protein accession: | NP_004928 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged CTNS is approximately 0.3ng/ml as a capture antibody. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Modulation of CTNS Gene Expression By Intracellular Thiols.Bellomo F, Corallini S, Pastore A, Palma A, Laurenzi C, Emma F, Taranta A. Free Radic Biol Med. 2010 Jan 14. [Epub ahead of print] |