Cart 43 Product Products 14 125,38 € (empty)
No products
To be determined Shipping
14 125,38 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 43 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 125,38 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 125,38 €
Data sheet of CTNS monoclonal antibody (M09), clone 5G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
More info about CTNS monoclonal antibody (M09), clone 5G6
| Brand: | Abnova |
| Reference: | H00001497-M09 |
| Product name: | CTNS monoclonal antibody (M09), clone 5G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTNS. |
| Clone: | 5G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1497 |
| Gene name: | CTNS |
| Gene alias: | CTNS-LSB|PQLC4 |
| Gene description: | cystinosis, nephropathic |
| Genbank accession: | NM_004937 |
| Immunogen: | CTNS (NP_004928, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY |
| Protein accession: | NP_004928 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CTNS is approximately 0.3ng/ml as a capture antibody. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Modulation of CTNS Gene Expression By Intracellular Thiols.Bellomo F, Corallini S, Pastore A, Palma A, Laurenzi C, Emma F, Taranta A. Free Radic Biol Med. 2010 Jan 14. [Epub ahead of print] |