| Brand: | Abnova |
| Reference: | H00001497-A01 |
| Product name: | CTNS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CTNS. |
| Gene id: | 1497 |
| Gene name: | CTNS |
| Gene alias: | CTNS-LSB|PQLC4 |
| Gene description: | cystinosis, nephropathic |
| Genbank accession: | NM_004937 |
| Immunogen: | CTNS (NP_004928, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY |
| Protein accession: | NP_004928 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CTNS polyclonal antibody (A01), Lot # 060623JCS1 Western Blot analysis of CTNS expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |